PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678392400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YA
Protein Properties Length: 153aa    MW: 16872.5 Da    PI: 10.0085
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678392400genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.51.3e-291874158
  CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
               dep+YVNaKQy++Il+RR++Rak e++ kl  k  kpylheSRh+hA+ R Rg gGrF
  678392400 18 DEPIYVNAKQYHGILRRRESRAKHEARCKL-VKRAKPYLHESRHRHAISRVRGAGGRF 74
               79****************************.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.3E-311677IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115232.0561777IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.9E-251974IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-222042IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.9E-225174IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 153 aa     Download sequence    Send to blast
MMGAPCGRIP LPAKLLDDEP IYVNAKQYHG ILRRRESRAK HEARCKLVKR AKPYLHESRH  60
RHAISRVRGA GGRFISTKKQ QTPPTEQQPP LNSYCSIVPV AEHQLTVNVE LPLQDAGNGL  120
IDNGKVIHAS SVPGEMPCHP CSSSLALSNV KCN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-221883267NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011093783.14e-37PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_011093784.14e-37PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X1
RefseqXP_011093785.14e-37PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2
RefseqXP_011093786.13e-37PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X3
SwissprotQ9SYH45e-31NFYA5_ARATH; Nuclear transcription factor Y subunit A-5
TrEMBLA0A0J8DZ111e-35A0A0J8DZ11_BETVU; Uncharacterized protein
TrEMBLS8BS703e-36S8BS70_9LAMI; Uncharacterized protein (Fragment)
STRINGPOPTR_0006s14740.13e-34(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA50092338
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-29nuclear factor Y, subunit A5